• Pharmaceutical Peptides
  • Cosmetic Peptides
  • Amino Acid
  • Custom Peptides
Elcatonin Acetate 
Elcatonin Acetate 
Product Name  Elcatonin Acetate Cas No. 57014-02-5
Molecular Formula C146H241N43O47S2 Molecular Weight 3414.87
GT #   GT Name  
Sequence CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (DISULFIDE BRIDGE: 1-7)
TEST SPECIFICATION
1、 Appearance White powder
2、 Purity (%)(HPLC) >98.0%
3、 Solubility Soluble in water or 1% HAc at a concentration of 1mg/ml to give a clear,colorless solution
4、 QC Data MS and HPLC
5、 Storage 2-8℃,keep dry and dark

 

Related products

CONTACT US

If you have any suggestions or opinions about our products,please leave a message,and we will immediately answer your questions. Thanks for your support.

  • Tel
  • Mail
  • Top
  • Address
  • Inquiry